PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID snap_masked-scaffold00336-abinit-gene-0.15-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NF-YB
Protein Properties Length: 226aa    MW: 22497.6 Da    PI: 7.7062
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
snap_masked-scaffold00336-abinit-gene-0.15-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB144.23.1e-452497275
                                              NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktin 63
                                                       reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktin
  snap_masked-scaffold00336-abinit-gene-0.15-mRNA-1 24 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTIN 85
                                                       89************************************************************ PP

                                              NF-YB 64 gddllwalatlG 75
                                                       gddllwa++tlG
  snap_masked-scaffold00336-abinit-gene-0.15-mRNA-1 86 GDDLLWAMTTLG 97
                                                       ***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471134.66E-32597IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.8E-421998IPR009072Histone-fold
PfamPF008087.4E-282993IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-115775No hitNo description
PROSITE patternPS0068506076IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-117694No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MADSDNDSGG HNNSNNANSE LSAREQDRFL PIANVSRIMK KALPANAKIS KDAKETVQEC  60
VSEFISFITG EASDKCQREK RKTINGDDLL WAMTTLGSIG RWKERRALWE EVEEEGGQVR  120
RMVAGGGGGS AGGGGAAGGG GGSGGGVSSS GNSGGYNGVG GMYAGMYGGV MGHHQGHVYG  180
SGGFHHHGIQ GIDGGVGVGK GGSVVGGGGG GGGGGGSNGG SIVRSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B2e-392497275Transcription factor HapC (Eurofung)
4g91_B2e-392497275Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003634760.14e-70PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_010644567.14e-70PREDICTED: nuclear transcription factor Y subunit B-3
TrEMBLD7UAG54e-70D7UAG5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t011e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-50nuclear factor Y, subunit B3